PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 229aa    MW: 26162.3 Da    PI: 8.4773
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005079genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.7e-151865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd+ll ++v+++G g+W++++++ g++R++k+ ++rw +yl
      Lus10005079 18 KGPWAPEEDKLLTEYVNLHGEGRWSSVSKCTGLKRSGKSSRLRWVNYL 65
                     79********************************************97 PP

2Myb_DNA-binding47.25e-1571114146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg  T++E+ + +++++ +G++ W+tIa++++ gRt++++k++w++
      Lus10005079  71 RGQLTPQEEGIVIELHAIWGNK-WSTIASYLP-GRTDNEIKNYWRT 114
                      7888******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3021365IPR017930Myb domain
SuperFamilySSF466897.49E-2815112IPR009057Homeodomain-like
SMARTSM007177.3E-131767IPR001005SANT/Myb domain
PfamPF002493.0E-141865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-201972IPR009057Homeodomain-like
CDDcd001673.14E-92065No hitNo description
PROSITE profilePS5129423.71166120IPR017930Myb domain
SMARTSM007176.6E-1270118IPR001005SANT/Myb domain
PfamPF002492.7E-1371114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2273119IPR009057Homeodomain-like
CDDcd001677.36E-975114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MERMMMRGYG VDEQGWRKGP WAPEEDKLLT EYVNLHGEGR WSSVSKCTGL KRSGKSSRLR  60
WVNYLRPGLK RGQLTPQEEG IVIELHAIWG NKWSTIASYL PGRTDNEIKN YWRTQFKKKS  120
SSSLPHNPKR QRKSSSSAVI NDQQMISDSH ANQSPGHDSS TIHDEKMQLD TLLLTDDNCQ  180
KQQQSCSVHN MMNEFEKNQW ADDHLVPAAA SGSGTIIEDW LWSGLWNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23181227110B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00388DAPTransfer from AT3G30210Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010113169.14e-73Transcription factor
TrEMBLW9SN564e-73W9SN56_9R
STRINGSolyc02g089190.1.18e-69(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF118234108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.16e-65myb domain protein 121